PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D03G1676
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 251aa    MW: 28462.1 Da    PI: 5.2206
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D03G1676genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.9e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+  Ed+ll ++++++G g+W+t +++ g++R++k+c++rw +yl
      Gh_D03G1676 14 RGAWSVKEDKLLSNYINLHGEGQWRTLPQKAGLNRCGKSCRLRWMNYL 61
                     89********************************************97 PP

2Myb_DNA-binding51.13.2e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ +++E++l+++++++lG++ W++Ia +++ gRt++++k++w++ 
      Gh_D03G1676  67 RGNISPDEEDLIIRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNTI 111
                      7899******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-21564IPR009057Homeodomain-like
PROSITE profilePS5129415.683961IPR017930Myb domain
SuperFamilySSF466891.29E-2812108IPR009057Homeodomain-like
SMARTSM007172.4E-121363IPR001005SANT/Myb domain
PfamPF002491.1E-141461IPR001005SANT/Myb domain
CDDcd001675.26E-91661No hitNo description
PROSITE profilePS5129425.16462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-2565117IPR009057Homeodomain-like
SMARTSM007178.9E-1666114IPR001005SANT/Myb domain
PfamPF002496.9E-1567111IPR001005SANT/Myb domain
CDDcd001678.37E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MGRKPCCLKE GVNRGAWSVK EDKLLSNYIN LHGEGQWRTL PQKAGLNRCG KSCRLRWMNY  60
LRPGIKRGNI SPDEEDLIIR LHRLLGNRWS LIAGRLPGRT DNEIKNYWNT ILSKKLNADV  120
SKKTSESEDM ESVGKYLSAG IITPVVPKAT RCTKIFFSSD EVQHLKNDQC PTLSTPTDTD  180
DGLTLESSKD DDVPDMDNAL DYFGFSQNGI ADVFENSNML ESDKLAPMFE TKFNNDLSSL  240
LEFEDDWTNF L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-24141187110B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5896811e-63JX589681.1 Gossypium hirsutum clone NBRI_GE24426 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012472580.11e-179PREDICTED: anthocyanin regulatory C1 protein-like
TrEMBLA0A0D2NV601e-179A0A0D2NV60_G
STRINGGSMUA_Achr6P04400_0017e-79(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2430634
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.13e-61myb domain protein 12